PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0063s0420.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 346aa    MW: 38437.9 Da    PI: 8.8133
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0063s0420.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.26.2e-2379123145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCs+++ +++k+CErH++r+r+rsrk +e+
  SapurV1A.0063s0420.4.p  79 DSEPGRCRRTDGKKWRCSKDAHPDSKYCERHMNRSRNRSRKLVES 123
                             689**************************************9986 PP

2QLQ55.12.3e-191953337
                     QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                            FT +Q+++L++Q+l++K+L+a++PvPp+Ll++i+k
  SapurV1A.0063s0420.4.p 19 FTVSQWHELEHQVLIFKCLNAGLPVPPDLLLPIRK 53
                            9********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-91753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.2771853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.8E-141952IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.14379123IPR014977WRC domain
PfamPF088791.4E-1981122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MSNSSVTVAA AGSRSPPCFT VSQWHELEHQ VLIFKCLNAG LPVPPDLLLP IRKSFQLLSP  60
GYLHPSNLSY CSYFGKKIDS EPGRCRRTDG KKWRCSKDAH PDSKYCERHM NRSRNRSRKL  120
VESQTTSQSL STVASEIATG SSSSGSRGYP TMPLPTLGNP GTLGLGSSMS RWQMESMPYG  180
VNSKDYRSLH GPKPEADEKT FLPESLENTR SFGMNSTVDS TWRLTSQVPA NPVPESRNGA  240
LLQNYPQVQT LQDFEPLTVD ATSSKQQQQH YLFGREFSSS GSMRRENQSL QPLFDEWPKC  300
RDMDSYLTDQ RSNKNSSAVQ LSMAIPMAPN PAARSYHSPN DEKDA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028067.10.0PREDICTED: growth-regulating factor 4-like isoform X1
RefseqXP_011028066.10.0PREDICTED: growth-regulating factor 4-like isoform X1
TrEMBLU5GUE90.0U5GUE9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s01480.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.17e-37growth-regulating factor 2